Invitrogen™ Human CGREF1 (aa 21-153) Control Fragment Recombinant Protein

Product Code. 30211609

Brand: Invitrogen™ RP89919

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52536 (PA5-52536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CGREF1 (cell growth regulator with EF-hand domain 1), also known as CGR11, is a 301 amino acid secreted protein that contains two highly conserved calcium binding EF-hand domains, which are required for mediating cell-cell adhesion. Induced by p53, CGREF1 is able to inhibit cell growth in various cell lines. CGREF1 is encoded by a gene located on human chromosome 2, which houses over 1,400 genes and comprises nearly 8% of the human genome. Harlequin icthyosis, a rare and morbid skin deformity, is associated with mutations in the ABCA12 gene, while the lipid metabolic disorder sitosterolemia is associated with defects in the ABCG5 and ABCG8 genes. Additionally, an extremely rare recessive genetic disorder, Alstrom syndrome, is caused by mutations in the ALMS1 gene, which maps to chromosome 2.

Specifications

• Accession Number: Q99674
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10669
• Name: Human CGREF1 (aa 21-153) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110004G24Rik; AW045201; cell growth regulator with EF hand domain 1; cell growth regulator with EF hand domain protein 1; cell growth regulator with EF-hand domain 1; cell growth regulatory gene 11 protein; cell growth regulatory with EF-hand domain; CGR11; Cgref1; Hydrophobestin
• Common Name: CGREF1
• Gene Symbol: CGREF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRHVEPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining