Invitrogen™ Human CGNL1 (aa 508-620) Control Fragment Recombinant Protein

Product Code. 30210186

Brand: Invitrogen™ RP107682

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84806 (PA5-84806. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Paracingulin (CGNL1, cingulin-like 1, FLJ14957, JACOP, KIAA1749) is novel protein with similar domain organization and significant sequence homology to cingulin, one of the tight junction (TJ) molecules. Paracingulin may play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.

Specifications

• Accession Number: Q0VF96
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84952
• Name: Human CGNL1 (aa 508-620) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933421H10Rik; 9930020M10Rik; AI503810; CGNL1; cingulin like 1; cingulin-like 1; cingulin-like protein 1; JACOP; Junction-associated coiled-coil protein; Kiaa1749; Paracingulin; PCING
• Common Name: CGNL1
• Gene Symbol: CGNL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NRATATSPDSGAKKISVKTFPSASNTQATPDLLKGQQELTQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGNNQACNSTSEVKDLLEQKSKLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining