Invitrogen™ Human cGKI (aa 233-349) Control Fragment Recombinant Protein

Product Code. 30211306

Brand: Invitrogen™ RP89820

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82310 (PA5-82310. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRKG1 is a cGMP-dependent serine/threonine kinase which has an important role in the relaxation of vascular smooth muscle and the inhibition of platelet aggregation. The PRKG1 proteins play a central role in regulating cardiovascular and neuronal functions in addition to relaxing smooth muscle tone, and modulating cell growth. This gene is most strongly expressed in all types of smooth muscle, platelets, cerebellar Purkinje cells, hippocampal neurons, and the lateral amygdala. Isoforms Ialpha and Ibeta have identical cGMP-binding and catalytic domains but differ in their leucine/isoleucine zipper and autoinhibitory sequences and therefore differ in their dimerization substrates and kinase enzyme activity.

Specifications

• Accession Number: Q13976
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5592
• Name: Human cGKI (aa 233-349) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AAT8; AW125416; cGK; cGK 1; CGK 1 alpha; cGK 1 beta; cGK cGK cGKI; cGK cGK1; cGK1; cGKI; cGKI-alpha; cGKI-BETA; cGMP dependent protein kinase type 1; cGMP kinase type I alpha; cGMP-dependent protein kinase 1; cGMP-dependent protein kinase 1, alpha isozyme; cGMP-dependent protein kinase 1, beta isozyme; cGMP-dependent protein kinase I; Gm19690; OTTHUMP00000019618; Pk.; Pkgi; Prkg1; PRKG1B; PRKGR1A; PRKGR1B; protein kinase cGMP-dependent 1; protein kinase, cGMP-dependent, regulatory, type I, beta; protein kinase, cGMP-dependent, type 1; protein kinase, cGMP-dependent, type I; RP11-346D6.1; Unknown (protein for MGC:134126); unnamed protein product
• Common Name: cGKI
• Gene Symbol: PRKG1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining