Invitrogen™ Human CGI-143 (aa 45-136) Control Fragment Recombinant Protein

Product Code. 30205028

Brand: Invitrogen™ RP89409

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52375 (PA5-52375. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CGI-143 encodes proteins that seem to be involved in cell proliferation or cell-cycle regulation, but the molecular function is still unknown.

Specifications

• Accession Number: Q9Y3E2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51027
• Name: Human CGI-143 (aa 45-136) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810037G04Rik; bolA family member 1; bolA homolog 1; Bola1; bolA-like 1; bolA-like 1 (E. coli); bolA-like protein 1; CGI-143; hBolA; hypothetical protein LOC509530; RGD1310586; zgc:101119
• Common Name: CGI-143
• Gene Symbol: BOLA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining