Invitrogen™ Human CFHR2 (aa 220-269) Control Fragment Recombinant Protein

Product Code. 30197369

Brand: Invitrogen™ RP104258

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62054 (PA5-62054. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Might be involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.

Specifications

• Accession Number: P36980
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3080
• Name: Human CFHR2 (aa 220-269) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CFHL2; CFHR2; complement factor H related 2; complement factor H-related 2; complement factor H-related protein 2; DDESK59; factor H-related gene 2; FHR2; FHR-2; H factor (complement)-like 3; h factor-like 3; H factor-like protein 2; HFL3
• Common Name: CFHR2
• Gene Symbol: CFHR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining