Invitrogen™ Human CFAP161 (aa 187-300) Control Fragment Recombinant Protein

Product Code. 30180661

Brand: Invitrogen™ RP98106

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59741 (PA5-59741. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CFAP161 may play a role in motile cilia function, possibly by acting on dynein arm assembly.

Specifications

• Accession Number: Q6P656
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 161502
• Name: Human CFAP161 (aa 187-300) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C15orf26; C3H15orf26; CFAP161; cilia and flagella associated protein 161; cilia- and flagella-associated protein 161; uncharacterized protein C15orf26
• Common Name: CFAP161
• Gene Symbol: CFAP161
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VSHVNCWQAAFPDPQLRLEYEGFPVPANAKILINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLVTGNPRDASSSMLDLPKPPTEDTRAMEQAMGLDT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining