Invitrogen™ Human CES7 (aa 67-118) Control Fragment Recombinant Protein

Product Code. 30182111

Brand: Invitrogen™ RP98685

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61561 (PA5-61561. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CES7 is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.

Specifications

• Accession Number: Q6NT32
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 221223
• Name: Human CES7 (aa 67-118) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700081L16Rik; 1700122C07Rik; BB081581; carboxylesterase 5; carboxylesterase 5 A; carboxylesterase 7; carboxylesterase-like urinary excreted protein homolog; CAUXIN; CES4C1; CES5; Ces5a; CES7; epididymis luminal protein 126; Gm503; HEL126
• Common Name: CES7
• Gene Symbol: CES5A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGSLRFTNPQPASPWDNLREATSYPNLCLQNSEWLLLDQHMLKVHYPKFGVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining