Invitrogen™ Human CES1 (aa 215-345) Control Fragment Recombinant Protein

Product Code. 30201024

Brand: Invitrogen™ RP88976

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82453 (PA5-82453. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene.

Specifications

• Accession Number: P23141
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1066
• Name: Human CES1 (aa 215-345) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACAT; acyl coenzyme A:cholesterol acyltransferase; acyl-coenzyme A:cholesterol acyltransferase; Brain carboxylesterase hBr1; carboxyesterase ES-3; carboxylesterase 1; carboxylesterase 1 (monocyte/macrophage serine esterase 1); carboxylesterase 1 A; carboxylesterase 1 E; Carboxylesterase 1 G; carboxylesterase 1-like; carboxylesterase 2 (liver); CE-1; CEH; Ces1; Ces-1; Ces1a; Ces1e; Ces1g; Ces1l; CES2; cholesteryl ester hydrolase; cocaine carboxylesterase; Eg; EG244595; Egasyn; Es22; Es-22; ES-HTEL; esterase 22; esterase-22; ES-x; Gm4976; hCE-1; HMSE; HMSE1; human monocyte/macrophage serine esterase 1; liver carboxylesterase 1; Liver carboxylesterase 22; liver carboxylesterase 3; methylumbelliferyl-acetate deacetylase 1; MGC117365; Monocyte/macrophage serine esterase; PCE-1; pI 5.5 esterase; REH; Retinyl ester hydrolase; serine esterase 1; SES1; Ses-1; TGH; triacylglycero; Triacylglycerol hydrolase
• Common Name: CES1
• Gene Symbol: CES1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining