Invitrogen™ Human CEP85L (aa 112-185) Control Fragment Recombinant Protein

Product Code. 30195365

Brand: Invitrogen™ RP94648

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56070 (PA5-56070. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene was identified as a breast cancer antigen. Nothing more is known of its function at this time. Three transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q5SZL2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 387119
• Name: Human CEP85L (aa 112-185) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bA57K17.2; C1H6orf204; C6orf204; centrosomal protein 85 like; centrosomal protein 85 kDa-like; centrosomal protein 85-like; centrosomal protein of 85 kDa-like; CEP85L; coiled-coil domain-containing c6orf204-like protein; ENSMUSG00000038594; Gm9766; LOW QUALITY PROTEIN: centrosomal protein of 85 kDa-like; NY-BR-15; rCG22129-like; serologically defined breast cancer antigen NY-BR-15
• Common Name: CEP85L
• Gene Symbol: CEP85L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKLRESLTPDGSKWSTSLMQTLGNHSRGEQDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESRNGLEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining