Invitrogen™ Human CEP76 (aa 435-551) Control Fragment Recombinant Protein

Product Code. 30180888

Brand: Invitrogen™ RP98210

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58772 (PA5-58772. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a centrosomal protein which regulates centriole amplification by limiting centriole duplication to once per cell cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012].

Specifications

• Accession Number: Q8TAP6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79959
• Name: Human CEP76 (aa 435-551) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6230425F05Rik; 9630013E05; C18orf9; centrosomal protein 76; centrosomal protein 76 kDa; centrosomal protein of 76 kDa; Cep76; CSG11; HsT1705; RGD1305183
• Common Name: CEP76
• Gene Symbol: CEP76
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining