Invitrogen™ Human CEP57L1 (aa 247-343) Control Fragment Recombinant Protein

Product Code. 30195679

Brand: Invitrogen™ RP95018

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59153 (PA5-59153. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C6orf182 also named as Centrosomal protein of 57 kDa related protein is a 460 amino-acid protein, which belongs to translokin family. C6orf182 as centrosomal protein may be required for microtubule attachment to centrosomes and localizes in the cytoplasm. The function of C6orf182 need to be further studied.

Specifications

• Accession Number: Q8IYX8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 285753
• Name: Human CEP57L1 (aa 247-343) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410017P07Rik; 4930484D11Rik; AI607327; bA487F23.2; C6orf182; centrosomal protein 57 like 1; centrosomal protein 57 kDa-like 1; centrosomal protein 57 kDa-like protein 1; centrosomal protein 57-like 1; Centrosomal protein CEP57L1; centrosomal protein of 57 kDa-related protein; CEP57L1; Cep57R; Cep57-related protein; RGD1311358
• Common Name: CEP57L1
• Gene Symbol: CEP57L1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining