Invitrogen™ Human CEP41 (aa 188-271) Control Fragment Recombinant Protein

Product Code. 30198046

Brand: Invitrogen™ RP92677

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54974 (PA5-54974. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Centrosomes are the major microtubule-organizing centers of mammalian cells. They are composed of a centriole pair and surrounding microtubule-nucleating material termed pericentriolar material (PCM). Bipolar mitotic spindle assembly relies on two intertwined processes: centriole duplication and centrosome maturation. Failure to properly orchestrate centrosome duplication and maturation is subsequently linked to spindle defects, which can result in aneuploidy and promote cancer progression. The CEP41 (centrosomal protein of 41 kDa) gene encodes a protein of 373 amino acids that is alternatively spliced into 4 isoforms. Isoforms 1 and 4 are expressed in testis, as well as in and fetal brain and liver.

Specifications

• Accession Number: Q9BYV8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 95681
• Name: Human CEP41 (aa 188-271) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700017E11Rik; 2810431D15Rik; centrosomal protein 41; centrosomal protein 41 kDa; centrosomal protein 41 kDa; centrosomal protein of 41 kDa; CEP41; JBTS15; testis specific gene A14; testis specific protein A14; testis specific, 14; testis-specific gene A14 protein; Tsga14
• Common Name: CEP41
• Gene Symbol: CEP41
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLITGSLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining