missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212255

Invitrogen™ Human CEP290 (aa 675-777) Control Fragment Recombinant Protein

Product Code. 30212255
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212255

Brand: Invitrogen™ RP107333

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84641 (PA5-84641. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15078
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80184
Name Human CEP290 (aa 675-777) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3H11Ag; b2b1454Clo; b2b1752Clo; Bardet-Biedl syndrome 14 protein; Bardet-Biedl syndrome 14 protein homolog; BBS14; BC004690; Cancer/testis antigen 87; centrosomal protein 290; centrosomal protein 290 kDa; centrosomal protein of 290 kDa; Cep290; CT87; CTCL tumor antigen se2-2; JBTS5; Kiaa0373; LCA10; Meckel syndrome, type 4; MKS4; monoclonal antibody 3H11 antigen; nephrocystin-6; nephrocytsin-6; Nphp6; POC3; POC3 centriolar protein homolog; prostate cancer antigen T21; rd16; RGD1311640; SLSN6; tumor antigen se2-2
Common Name CEP290
Gene Symbol Cep290
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASII
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.