Invitrogen™ Human CEP112 (aa 459-535) Control Fragment Recombinant Protein

Product Code. 30211863

Brand: Invitrogen™ RP93358

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55088 (PA5-55088. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.

Specifications

• Accession Number: Q8N8E3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 201134
• Name: Human CEP112 (aa 459-535) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700001M19Rik; 1700029K01Rik; 8430407H02Rik; AV043680; AV207351; CCDC46; centrosomal protein 112; centrosomal protein 112 kDa; centrosomal protein of 112 kDa; centrosomal protein of 112 kDa; LOW QUALITY PROTEIN: centrosomal protein of 112 kDa; Cep112; coiled-coil domain containing 46; coiled-coil domain-containing protein 46; Macoco; RGD1564168
• Common Name: CEP112
• Gene Symbol: CEP112
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining