missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206762

Invitrogen™ Human CENTG1 (aa 590-665) Control Fragment Recombinant Protein

Product Code. 30206762
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206762

Brand: Invitrogen™ RP109502

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140279 (PA5-140279. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the centaurin gamma-like family. It mediates anti-apoptotic effects of nerve growth factor by activating nuclear phosphoinositide 3-kinase. It is overexpressed in cancer cells, and promotes cancer cell invasion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99490
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 116986
Name Human CENTG1 (aa 590-665) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AGAP2; AGAP-2; Arf GAP with GTP-binding protein-like, ANK repeat and PH domains 2; ArfGAP with GTPase domain, ankyrin repeat and PH domain 2; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2; centaurin gamma1; centaurin, gamma 1; centaurin-gamma-1; CENTG1; cnt-g1; FLJ16430; GGAP2; GTP-binding and GTPase activating protein 2; GTP-binding and GTPase-activating protein 2; KIAA0167; mKIAA0167; nuclear GTPase PIKE; phosphatidylinositol 3-kinase enhancer; phosphatidylinositol-3-kinase enhancer; phosphoinositide 3-kinase enhancer; Pike
Common Name CENTG1
Gene Symbol Agap2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.