Invitrogen™ Human CENPN (aa 2-85) Control Fragment Recombinant Protein

Product Code. 30211849

Brand: Invitrogen™ RP106423

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65747 (PA5-65747. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly.

Specifications

• Accession Number: Q96H22
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55839
• Name: Human CENPN (aa 2-85) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610510J17Rik; AI426416; ATM interactor; centromere protein N; AW545024; BM039; BM-309; C16orf60; Cenpn; CENP-N; Centromere protein N; Da2-27; Da2-4; FLJ13607; FLJ22660; ICEN32; Interphase centromere complex protein 32; RGD1310953; Unknown (protein for MGC:133728)
• Common Name: CENPN
• Gene Symbol: Cenpn
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWEV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining