Invitrogen™ Human CENPJ (aa 720-846) Control Fragment Recombinant Protein

Product Code. 30201173

Brand: Invitrogen™ RP107007

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66326 (PA5-66326. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that belongs to the centromere protein family. During cell division, this protein plays a structural role in the maintenance of centrosome integrity and normal spindle morphology, and it is involved in microtubule disassembly at the centrosome. This protein can function as a transcriptional coactivator in the Stat5 signaling pathway, and also as a coactivator of NF-kappaB-mediated transcription, likely via its interaction with the coactivator p300/CREB-binding protein. Mutations in this gene are associated with primary autosomal recessive microcephaly, a disorder characterized by severely reduced brain size and mental retardation.

Specifications

• Accession Number: Q9HC77
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55835
• Name: Human CENPJ (aa 720-846) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932437H03Rik; BM032; Cenpj; CENP-J; Centromere protein J; centrosomal P4.1-associated protein; CPAP; Gm81; LAG-3-associated protein; LAP; LIP1; LYST-interacting protein 1; LYST-interacting protein LIP1; LYST-interacting protein LIP7; MCPH6; microcephaly; Sas4; Sas-4; SASS4; SCKL4
• Common Name: CENPJ
• Gene Symbol: CENPJ
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DRERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIMESIKHKVSEPSRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKRKIAPVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining