Invitrogen™ Human CENPF (aa 620-761) Control Fragment Recombinant Protein

Product Code. 30206440

Brand: Invitrogen™ RP110098

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144905 (PA5-144905. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that associates with the centromere-kinetochore complex. The protein is a component of the nuclear matrix during the G2 phase of interphase. In late G2 the protein associates with the kinetochore and maintains this association through early anaphase. It localizes to the spindle midzone and the intracellular bridge in late anaphase and telophase, respectively, and is thought to be subsequently degraded. The localization of this protein suggests that it may play a role in chromosome segregation during mitosis. It is thought to form either a homodimer or heterodimer. Autoantibodies against this protein have been found in patients with cancer or graft versus host disease.

Specifications

• Accession Number: P49454
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1063
• Name: Human CENPF (aa 620-761) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6530404A22Rik; AH antigen; AI325968; cell-cycle-dependent 350 K nuclear protein; CENF; CENPF; CENP-F; CENP-F kinetochore protein; centromere autoantigen F; centromere protein F; centromere protein F, (mitosin); centromere protein F, 350/400 ka (mitosin); centromere protein F, 350/400 kDa (mitosin); CILD31; hcp-1; im:7140452; im:7144238; im:7154719; im:7156761; kinetochore protein CENPF; Lek1; leucine, glutamic acid, lysine family 1 protein; mitosin; PRO1779; RP11-262H5.1; si:ch211-152h14.2; STROMS
• Common Name: CENPF
• Gene Symbol: CENPF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SCWKSENEKLLTQMESEKENLQSKINHLETCLKTQQIKSHEYNERVRTLEMDRENLSVEIRNLHNVLDSKSVEVETQKLAYMELQQKAEFSDQKHQKEIENMCLKTSQLTGQVEDLEHKLQLLSNEIMDKDRCYQDLHAEYE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining