Invitrogen™ Human CENPE (aa 392-509) Control Fragment Recombinant Protein

Product Code. 30196638

Brand: Invitrogen™ RP89483

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144699 (PA5-144699, PA5-59939 (PA5-59939. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

14-3-3 sigma (stratifin, SFN, epithelial cell marker protein 1) is a member of a highly conserved family of 14-3-3 proteins that are present in all eukaryotic organisms. There are 7 known mammalian 14-3-3 isoforms epsilon, beta, zeta, gamma, theta, tau and they play important roles in many biological activities by binding to and altering the subcellular localization and/or stability of key molecules in various signaling cascades. 14-3-3 sigma was originally characterized as a human mammary epithelium marker and later rediscovered as an important molecule for cell cycle checkpoint regulation. Recently it has been reported that 14-3-3 sigma may serve as a prognosis marker predicting survival of pancreatic cancer patient treatment. 14-3-3 sigmais the only 14-3-3 isoform induced by the tumor suppressor protein p53, in response to g-irradiation and other DNA-damaging agents. 14-3-3 sigmais a p53-regulated inhibitor of G2/M progression and acts as a tumor suppressor gene that is inactivated by methylation of its 5' CpG islands in epithelial tumor cells. Two isoforms of human 14-3-3 sigma are produced by alternative splicing.

Specifications

• Accession Number: Q02224
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1062
• Name: Human CENPE (aa 392-509) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 312 kDa; AU019344; BC049989; C530022J18; Cenpe; CENP-E; centromere autoantigen E; Centromere autoantigen E (312 kD); centromere protein E; centromere protein E, 312 kDa; centromere-associated protein E; centromeric protein E; KIF10; kinesin 10; kinesin family member 10; kinesin superfamily protein 10; Kinesin-7; Kinesin-related protein CENPE; MCPH13; Motor domain of KIF10; N-7 kinesin; PPP1R61; protein phosphatase 1, regulatory subunit 61
• Common Name: CENPE
• Gene Symbol: CENPE
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining