missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CEL (aa 297-424) Control Fragment Recombinant Protein

Product Code. 30210920
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210920

Brand: Invitrogen™ RP89670

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62668 (PA5-62668. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Caboxyl Ester Lipase (CEL), also known as Bile Salt-Activated Lipase, catalyzes the hydrolysis of a wide range of substrates including cholesteryl esters, phospholipids, lysophospholipids, di- and tri-acylglycerols, and fatty acid esters of hydroxy fatty acids (FAHFAs). Preferentially hydrolyzes FAHFAs with the ester bond further away from the carboxylate. Unsaturated FAHFAs are hydrolyzed more quickly than saturated FAHFAs. It also has an essential role in the complete digestion of dietary lipids and their intestinal absorption, along with the absorption of fat-soluble vitamins. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19835
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1056
Name Human CEL (aa 297-424) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810036E18Rik; BAL; Bile salt-activated lipase; bile salt-dependent lipase, oncofetal isoform; bile salt-stimulated lipase; BSDL; BSSL; bucelipase; carboxyl ester hydrolase; carboxyl ester lipase; carboxyl ester lipase (bile salt-stimulated lipase); CEase; Cel; CELL; Cholesterol esterase; FAP; FAPP; fetoacinar pancreatic protein; Lip1; LIPA; LOW QUALITY PROTEIN: bile salt-activated lipase; lysophospholipase, pancreatic; MODY8; pancreatic lysophospholipase; Sterol esterase
Common Name CEL
Gene Symbol CEL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.