Invitrogen™ Human CEACAM21 (aa 38-93) Control Fragment Recombinant Protein

Product Code. 30182015

Brand: Invitrogen™ RP98853

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60354 (PA5-60354. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CEACAM21 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 21) is a Protein Coding gene. An important paralog of this gene is CEACAM1.

Specifications

• Accession Number: Q3KPI0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90273
• Name: Human CEACAM21 (aa 38-93) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: carcinoembryonic antigen related cell adhesion molecule 21; carcinoembryonic antigen-related cell adhesion molecule 21; CEACAM21; CEACAM3; R29124_1; UNQ3098/PRO10075
• Common Name: CEACAM21
• Gene Symbol: CEACAM21
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining