Invitrogen™ Human CEA (aa 460-529) Control Fragment Recombinant Protein

Product Code. 30202013

Brand: Invitrogen™ RP92402

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82695 (PA5-82695. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CEA (Carcino Embryonic Antigen, CD66e) is synthesized during development in the fetal gut, and re-expressed in increased amounts in intestinal carcinomas and several other tumors. CEA is a member of carcinoembryonic antigens, immunoglobulin supergene family and consists of a single N domain (structural homology to the immunoglobulin variable) and six immunoglobulin constant-like A (A1, A2, A3) and B domains (B1, B2, B3). Antibodies to CEA are useful in identifying the origin of various metastatic adenocarcinomas and in distinguishing pulmonary adenocarcinomas (60 to 70% are CEA+) from pleural mesotheliomas (rarely or weakly CEA+). CEA is a member of a large family of glycoproteins, a useful tumor marker for adenocarcinoma, and found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. CEA was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, CEA was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of all variants has not been defined.

Specifications

• Accession Number: P06731
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1048
• Name: Human CEA (aa 460-529) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1600029H12Rik; Carcinoembryonic antigen; carcinoembryonic antigen related cell adhesion molecule 5; carcinoembryonic antigen-related cell adhesion molecule 5; CD66e; CEA; CEACAM5; Meconium antigen 100; OTTHUMP00000199033; pregnancy-specific glycoprotein 30; Psg30; sCD66e; soluble CD66e
• Common Name: CD66e (CEACAM5)
• Gene Symbol: Ceacam5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining