missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CDY2B (aa 57-95) Control Fragment Recombinant Protein

Product Code. 30208209
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208209

Brand: Invitrogen™ RP109109

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140322 (PA5-140322. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDY2B encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Two nearly identical copies of this gene are found in a palindromic region on chromosome Y; this record represents the centromeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6F7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 203611
Name Human CDY2B (aa 57-95) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CDY; CDY2; CDY2A; CDY2B; chromodomain protein, Y chromosome, 2 related; chromodomain protein, Y-linked, 2 B; testis-specific chromodomain protein Y 2; testis-specific chromodomain protein Y protein 2 related; Y chromosome chromodomain protein 2 B
Common Name CDY2B
Gene Symbol CDY2B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.