Invitrogen™ Human CDY2B (aa 57-95) Control Fragment Recombinant Protein

Product Code. 30208209

Brand: Invitrogen™ RP109109

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140322 (PA5-140322. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDY2B encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Two nearly identical copies of this gene are found in a palindromic region on chromosome Y; this record represents the centromeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes.

Specifications

• Accession Number: Q9Y6F7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 203611
• Name: Human CDY2B (aa 57-95) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CDY; CDY2; CDY2A; CDY2B; chromodomain protein, Y chromosome, 2 related; chromodomain protein, Y-linked, 2 B; testis-specific chromodomain protein Y 2; testis-specific chromodomain protein Y protein 2 related; Y chromosome chromodomain protein 2 B
• Common Name: CDY2B
• Gene Symbol: CDY2B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining