missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210124

Invitrogen™ Human CDNF (aa 131-182) Control Fragment Recombinant Protein

Product Code. 30210124
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210124

Brand: Invitrogen™ RP97191

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60764 (PA5-60764. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The conserved dopamine neurotrophic factor (CDNF) is a neurotrophic factor for dopaminergic neurons and highly homologous to the mesencephalic-astrocyte-derived neuro-trophic factor. Somewhat surprisingly, CDCF is expressed at higher levels in tissues such as heart, skeletal muscle and testes than in brain. Similar to the glial cell line-derived neurotrophic factor (GDNF), CDNF can prevent the 6-hydroxylamine (6 OHDA) induced degeneration of dopaminergic neurons in a rat model of Parkinsons disease. Furthermore, CDNF was able to restore the dopaminergic function and prevent the degeneration of dopaminergic neurons in the substantia nigra, suggesting that CDNF might be suitable for the treatment of Parkinsons disease. At least two isoforms of CDNF are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q49AH0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 441549
Name Human CDNF (aa 131-182) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9330140G23; arginine-rich protein mutated in early stage tumors-like 1; arginine-rich, mutated in early stage tumors-like 1; ARMETL1; ARMET-like protein 1; Cdnf; Cerebral dopamine neurotrophic factor; conserved dopamine neurotrophic factor
Common Name CDNF
Gene Symbol Cdnf
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.