missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206533

Invitrogen™ Human CDKN2B (aa 1-37) Control Fragment Recombinant Protein

Product Code. 30206533
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206533

Brand: Invitrogen™ RP103503

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111563 (PA5-111563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The four known 15-to 19 kDa INK4 proteins (p15INK4b, p16INK4a, p18INK4c andp19INK4d) bind and inhibit CDK4 and CDK6 but not other CDKs, including cyclin E-Cdk2, cyclin A-Cdk2 and cyclin B-Cdk1. Like the three D-type cyclins, the INK4 genes are expressed in distinct tissue-specific patterns, suggesting that they are not strictly redundant. 5 p18INK4c is expressed during G1 to S transition in the eukaryotic cell division cycle. It is maximally induced as cells enter S-phase.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P42772
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1030
Name Human CDKN2B (aa 1-37) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AV083695; CDK inhibitory protein; CDK4B inhibitor; CDK4I; Cdkn2b; cyclin dependent kinase inhibitor 2 B; Cyclin dependent kinase inhibitor 2 B (p15, inhibits CDK4); cyclin-dependent kinase 4 inhibitor B; cyclin-dependent kinase inhibitor 2 B (p15, inhibits CDK4); cyclin-dependent kinase inhibitor p15; cyclin-dependent kinase inhibitor p15INK4b; cyclin-dependent kinase inhibitor protein; cyclin-dependent kinases 4 and 6 binding protein; Ink4; INK4B; MTS2; MTS-2; Multiple tumor suppressor 2; p14_CDK inhibitor; p14_INK4B; p14-INK4b; P15; p15 CDK inhibitor; p15(INK4b); p15_INK4B; p15INK4b; p15-INK4b; TP15
Common Name CDKN2B
Gene Symbol CDKN2B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.