Invitrogen™ Human CDKN2AIP (aa 504-573) Control Fragment Recombinant Protein

Product Code. 30201842

Brand: Invitrogen™ RP96726

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59549 (PA5-59549. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.

Specifications

• Accession Number: Q9NXV6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55602
• Name: Human CDKN2AIP (aa 504-573) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921511I16Rik; AW208986; CARF; CDKN2A interacting protein; CDKN2A-interacting protein; CDKN2A-interacting protein-like protein; Cdkn2aip; CDKN2AIP-like protein; collaborates/cooperates with ARF (alternate reading frame) protein; collaborator of ARF; MGC137334 protein; RGD1305302
• Common Name: CDKN2AIP
• Gene Symbol: Cdkn2aip
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLLDEESRPVNLPPAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining