Invitrogen™ Human CDKL2 (aa 220-347) Control Fragment Recombinant Protein

Product Code. 30210276

Brand: Invitrogen™ RP89787

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83507 (PA5-83507. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The activation of signal transduction pathways by growth factors, hormones and neurotransmitters is mediated by the MAP kinases ERK 1 and ERK 2. ERK proteins are regulated by dual phosphorylation at specific tyrosine and threonine sites mapping within a characteristic Thr-Glu-Tyr motif. The protein kinase p56 KKIAMRE is distantly related to the MAP kinase group of proteins and is closely related to p42 KKIALRE. KKIAMRE is predominantly expressed in testis, kidney, brain and lung. KKIAMRE contains the conserved MAP kinase dual phosphorylation motif in the sequence Thr-Asp-Tyr and is activated by treatment of cells by EGF. However, unlike other MAP kinases, the EGF-stimulated kinase activity does not require phosphorylation of KKIAMRE and KKIALRE in the Thr-Asp-Tyr motif.

Specifications

• Accession Number: Q92772
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8999
• Name: Human CDKL2 (aa 220-347) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5330436L21Rik; AI505225; CDC2-related kinase; Cdkl2; cyclin dependent kinase like 2; cyclin-dependent kinase-like 2; cyclin-dependent kinase-like 2 (CDC2-related kinase); Kkiamre; Kkm; P56; p56 KKIAMRE protein kinase; protein kinase p56 KKIAMRE; serine/threonine protein kinase KKIAMRE; serine/threonine-protein kinase KKIAMRE; testicular tissue protein Li 35
• Common Name: CDKL2
• Gene Symbol: CDKL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining