Invitrogen™ Human CDKL1 (aa 308-353) Control Fragment Recombinant Protein

Product Code. 30209350

Brand: Invitrogen™ RP107465

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66809 (PA5-66809. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Alternative splice variants encoding different protein isoforms have been described, but their full-length nature has not been determined.

Specifications

• Accession Number: Q00532
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8814
• Name: Human CDKL1 (aa 308-353) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933411O17Rik; CDC2-related kinase 1; Cdkl1; cyclin dependent kinase like 1; cyclin-dependent kinase-like 1; cyclin-dependent kinase-like 1 (CDC2-related kinase); KKIALRE; P42; protein kinase p42 KKIALRE; serine/threonine protein kinase KKIALRE; serine/threonine-protein kinase KKIALRE; zgc:101002
• Common Name: CDKL1
• Gene Symbol: CDKL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining