Invitrogen™ Human CDK9 (aa 236-369) Control Fragment Recombinant Protein

Product Code. 30212866

Brand: Invitrogen™ RP102521

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK9 is a serine/threonine kinase which when complexed with CyclinT1 forms an active holoenzyme complex. This complex plays a key role in regulating the eukaryotic cell cycle. CDK9 is coexpressed and copurified with CyclinT1. CDK9 regulates cytokine inducible transcription networks by facilitating promoter recognition of target transcription factors. CDK9 promotes RNA synthesis in genetic programs for cell growth, differentiation, and viral pathogenesis. The CDK9/cyclin-K complex also has kinase activity towards CTD of RNAPII and can substitute for CDK9/cyclin-T P-TEFb in vitro. Chronic activation of CDK9 causes cardiac myocyte enlargement leading to cardiac hypertrophy and confers a predisposition to heart failure.

Specifications

• Accession Number: P50750
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1025
• Name: Human CDK9 (aa 236-369) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C-2 k; CDC2L4; CDC2-related kinase; Cdk9; Cell division cycle 2-like protein kinase 4; Cell division protein kinase 9; CTK1; cyclin dependent kinase 9; cyclin-dependent kinase 9; cyclin-dependent kinase 9 (CDC2-related kinase); PITALRE; RP11-228B15.5; serine/threonine protein kinase PITALRE; Serine/threonine-protein kinase PITALRE; TAK; Tat-associated kinase complex catalytic subunit
• Common Name: CDK9
• Gene Symbol: CDK9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining