missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDK6 Partial ORF (NP_001250, 3 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

£280.00 - £425.00

Specifications

Accession Number NP_001250
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 1021
Molecular Weight (g/mol) 36.41kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16083815
View Documents Promotion Details
Abnova™
H00001021-Q02.25UG
25 ug
£425.00
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 17-07-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16073815
View Documents Promotion Details
Abnova™
H00001021-Q02.10UG
10 ug
£280.00
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 17-07-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. [provided by RefSeq]

Sequence: KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE
Specifications

Specifications

NP_001250
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.41kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC59692/PLSTIRE/STQTL11
CDK6
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
1021
CDK6 (Human) Recombinant Protein (Q02)
KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE
RUO
CDK6
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications