Invitrogen™ Human CDK5RAP2 (aa 1307-1387) Control Fragment Recombinant Protein

Product Code. 30199295

Brand: Invitrogen™ RP96563

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK5RAP2 is a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein is localized to the centrosome and Golgi complex and interacts with CDK5R1 and pericentrin (PCNT). CDK5RAP2 plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimer's disease. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q96SN8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55755
• Name: Human CDK5RAP2 (aa 1307-1387) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C48; CDK5 activator-binding protein C48; CDK5 regulatory subunit associated protein 2; CDK5 regulatory subunit-associated protein 2; CDK5RAP2; centrosomal protein 215 kDa; Centrosome-associated protein 215; centrosomin; Cep215; KIAA1633; MCPH3
• Common Name: CDK5RAP2
• Gene Symbol: CDK5RAP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining