Invitrogen™ Human CDK4 (aa 211-303) Control Fragment Recombinant Protein

Product Code. 30211868

Brand: Invitrogen™ RP104550

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK4/cyclin D3 serine/threonine kinase is dimeric protein complex. CDK4 is a member of the cyclin-dependent protein kinase family and is involved in the control of cell proliferation during the G1 phase of cell cycle. CDK4 forms a complex with the D-type cyclins and is inhibited by p16 (cyclin-dependent kinase inhibitor-2). CDK4 can mediate phosphorylation of the C-terminal region of Rb protein leading to an active transcriptional repression of E2F complex. CDC37 and HSP90 can preferentially associate with the fraction of CDK4 not bound to D-type cyclins. SMAD3 is a major physiologic substrate of the G1 cyclin-dependent kinases CDK4 and CDK2. Although CDK6 and CDK4 can both phosphorylate multiple residues in the Rb protein, they do so with different residue selectivity in vitro; CDK6 phosphorylates Thr821 while CDK4 phosphorylates Thr826 on Rb protein.

Specifications

• Accession Number: P11802
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1019
• Name: Human CDK4 (aa 211-303) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cdk4; Cell division protein kinase 4; CMM3; Crk3; cyclin dependent kinase 4; cyclin-dependent kinase 4; MGC14458; PSK-J3; serine/threonine kinase; Unknown (protein for MGC:133903)
• Common Name: CDK4
• Gene Symbol: Cdk4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining