Invitrogen™ Human CDK2AP1 (aa 30-77) Control Fragment Recombinant Protein

Product Code. 30197285

Brand: Invitrogen™ RP106793

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66098 (PA5-66098. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Specifications

• Accession Number: O14519
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8099
• Name: Human CDK2AP1 (aa 30-77) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Apc10; CDK2 (cyclin-dependent kinase 2)-associated protein 1; Cdk2ap1; CDK2-associated protein 1; CDKAP1; cyclin dependent kinase 2 associated protein 1; cyclin-dependent kinase 2 associated protein 1; cyclin-dependent kinase 2-associated protein 1; Deleted in oral cancer 1; Deleted in oral cancer-1; Doc1; doc-1; DORC1; p12; p12DOC-1; Putative oral cancer suppressor; ST19
• Common Name: CDK2AP1
• Gene Symbol: CDK2AP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining