Invitrogen™ Human CDK20 (aa 167-260) Control Fragment Recombinant Protein

Product Code. 30210086

Brand: Invitrogen™ RP89797

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52464 (PA5-52464. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Specifications

• Accession Number: Q8IZL9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23552
• Name: Human CDK20 (aa 167-260) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932702G04Rik; AU019450; AW558027; CAK-kinase p42; Ccrk; CDCH; CDK20; CDK-activating kinase p42; CDK-related protein kinase PNQLARE; cell cycle related kinase; cell cycle-related kinase; Cell division protein kinase 20; cyclin dependent kinase 20; cyclin-dependent kinase 20; Cyclin-dependent protein kinase H; cyclin-kinase-activating kinase p42; p42; PNQALRE; PNQLARE
• Common Name: CDK20
• Gene Symbol: CDK20
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining