Invitrogen™ Human CDHR3 (aa 805-885) Control Fragment Recombinant Protein

Product Code. 30205651

Brand: Invitrogen™ RP90191

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52805 (PA5-52805. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell type.

Specifications

• Accession Number: Q6ZTQ4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 222256
• Name: Human CDHR3 (aa 805-885) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cadherin; cadherin related family member 3; cadherin-like protein 28; Cadherin-related family member 3; CDH28; CDHR3; FLJ23834; FLJ43271; MGC133292; MGC133293
• Common Name: CDHR3
• Gene Symbol: CDHR3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining