Invitrogen™ Human CDH17 (aa 174-254) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30196774	100 μL	100µL

Product Code. 30196774 Supplier Invitrogen™ Supplier No. RP93741

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54843 (PA5-54843. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDH17 gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q12864
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1015
• Name: Human CDH17 (aa 174-254) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BILL-cadherin; Cadherin; cadherin 17; cadherin 17, LI cadherin (liver-intestine); cadherin-16; cadherin-17; CDH16; CDH17; FLJ26931; HPT1; HPT-1; HPT-1 cadherin; HPT-1/LI; human intestinal peptide-associated transporter HPT-1; human peptide transporter 1; intestinal peptide-associated transporter HPT-1; LI cadherin; LI-cadherin; Liver-intestine cadherin; MGC138218; MGC142024; P130
• Common Name: CDH17
• Gene Symbol: Cdh17
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining