Invitrogen™ Human CDCA8 (aa 11-102) Control Fragment Recombinant Protein

Product Code. 30194379

Brand: Invitrogen™ RP94214

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55808 (PA5-55808. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDCA8 is a component of a chromosomal passenger complex (CPC) required for stability of the bipolar mitotic spindle. The chromosomal passenger complex, which includes Survivin, CDCA8, INCENP and Aurora-B, is known to play crucial roles during mitosis and cell division. It was found that CDCA8 interacting with Aurora-B, INCENP and Survivin, increases during G2/M phase and then reduces after exit from M phase. CDCA8 is cell cycle regulated, down-regulated in response to p53/Rb-signaling, and up-regulated in many types of cancerous tissues. In Drosophila cells, inactivation of CDCA8 results in polyploidy, delayed mitosis and abnormal tissue development, indicating its critical role for cell proliferation. Recent studies show that CDCA8 is essential for cell proliferation during early embryonic development, and its early embryonic lethality cannot be rescued by the loss of p53. Its aberrant expression is linked to a poor prognosis for gastric cancer.

Specifications

• Accession Number: Q53HL2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55143
• Name: Human CDCA8 (aa 11-102) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4831429J16Rik; AU044747; BOR; Borealin; Cdca8; cell division cycle associated 8; cell division cycle-associated protein 8; D4Ertd421e; Dasra B; DasraB; dasra-B; embryonic stem cell-related; hDasra-B; MESrg; MESRGP; PESCRG3; Pluripotent embryonic stem cell-related gene 3 protein
• Common Name: CDCA8
• Gene Symbol: CDCA8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILRLPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining