Invitrogen™ Human CDCA5 (aa 39-143) Control Fragment Recombinant Protein

Product Code. 30206222

Brand: Invitrogen™ RP88830

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54867 (PA5-54867. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Specifications

• Accession Number: Q96FF9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 113130
• Name: Human CDCA5 (aa 39-143) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610036L13Rik; AL024086; AW536684; C85404; Cdca5; cell division cycle associated 5; cell division cycle-associated protein 5; p35; RGD1560863; sororin; sororin p35
• Common Name: CDCA5
• Gene Symbol: CDCA5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining