Invitrogen™ Human CDCA3 (aa 152-252) Control Fragment Recombinant Protein

Product Code. 30199648

Brand: Invitrogen™ RP88748

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110918 (PA5-110918. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase. [UniProt]

Specifications

• Accession Number: Q99618
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83461
• Name: Human CDCA3 (aa 152-252) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410005A12Rik; C8; CDCA 3; CDCA3; cell division cycle associated 3; cell division cycle-associated protein 3; gene rich cluster, C8; gene-rich cluster protein C8; GRCC 8; GRCC8; MGC2577; TOME 1; Tome1; TOME-1; trigger of mitotic entry 1; trigger of mitotic entry protein 1
• Common Name: CDCA3
• Gene Symbol: CDCA3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining