missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205387

Invitrogen™ Human Cdc5L (aa 419-557) Control Fragment Recombinant Protein

Product Code. 30205387
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205387

Brand: Invitrogen™ RP102482

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52823 (PA5-52823. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99459
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 988
Name Human Cdc5L (aa 419-557) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200002I02Rik; AA408004; CDC5; CDC5 cell division cycle 5-like; CDC5 cell division cycle 5-like (S. pombe); CDC5L; CDC5-LIKE; Cdc5-like protein; Cdc5-related protein; CEF1; cell division cycle 5 like; cell division cycle 5-like; cell division cycle 5-like (S. pombe); cell division cycle 5-like protein; cell division cycle 5-related protein; dJ319D22.1; dJ319D22.1 (CDC5-like protein); hCDC5; KIAA0432; Pcdc5rp; Pombe cdc5-related protein; Unknown (protein for MGC:128482); zgc:55853
Common Name CDC5L
Gene Symbol CDC5L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.