Invitrogen™ Human CDC42SE2 (aa 31-84) Control Fragment Recombinant Protein

Product Code. 30202786

Brand: Invitrogen™ RP96913

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58472 (PA5-58472. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.

Specifications

• Accession Number: Q9NRR3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56990
• Name: Human CDC42SE2 (aa 31-84) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810404F18Rik; AA408783; AA536669; CDC42 small effector 2; CDC42 small effector protein 2; Cdc42se2; non-kinase Cdc42 effector protein SPEC2; RGD1563924; small effector of CDC42 protein 2; SPEC2
• Common Name: CDC42SE2
• Gene Symbol: CDC42SE2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining