Invitrogen™ Human Cdc14B (aa 20-73) Control Fragment Recombinant Protein

Product Code. 30209918

Brand: Invitrogen™ RP108501

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDC14B is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms.

Specifications

• Accession Number: O60729
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8555
• Name: Human Cdc14B (aa 20-73) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810432N10Rik; A530086E13Rik; AA472821; CDC14 cell division cycle 14 homolog B; CDC14 cell division cycle 14 B; CDC14B; Cdc14B1; Cdc14B2; CDC14B3; cell division cycle 14 B; dual specificity protein phosphatase CDC14B; hCDC14B
• Common Name: CDC14B
• Gene Symbol: CDC14B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining