missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD98 (aa 245-385) Control Fragment Recombinant Protein

Product Code. 30208251
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208251

Brand: Invitrogen™ RP90434

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82611 (PA5-82611. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD98 (4F2) is a type II transmembrane glycoprotein which serves as the heavy chain of the heterodimeric amino acid transporters (HATs). CD98, linked to various light chains by disulfide bond, is responsible for cell surface expression and basolateral localization of this transporter complex in polarized epithelial cells and also interacts with beta1 integrins and increases their affinity for ligand. Besides its roles in amino acid transport, CD98 is thus involved in cell fusion and activation. It is implicated in regulation of cellular differentiation, growth and apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P08195
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6520
Name Human CD98 (aa 245-385) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4F2; 4F2 cell-surface antigen heavy chain; 4F2 heavy chain antigen; 4F2hc; 4T2HC; AI314110; antigen defined by monoclonal antibody 4F2, heavy chain; antigen identified by monoclonal antibodies 4F2; antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43; Cd98; CD98 antigen; CD98 heavy chain; CD98HC; Ly10; Ly-10; Ly-m10; Lymphocyte activation antigen 4F2 large subunit; MDU1; Mgp-2 hc; monoclonal antibody 44D7; NACAE; RGD:3073}; SLC3A2; slc3a2 {ECO:0000312; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; solute carrier family 3 (amino acid transporter heavy chain), member 2; solute carrier family 3 member 2; solute carrier family 3, member 2; type II transmembrane protein
Common Name CD98
Gene Symbol SLC3A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.