Invitrogen™ Human CD51 (aa 884-984) Control Fragment Recombinant Protein

Product Code. 30196307

Brand: Invitrogen™ RP88635

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82171 (PA5-82171. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ITAGV encodes integrin alpha chain V. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The I-domain containing integrin alpha V undergoes post-translational cleavage to yield disulfide-linked heavy and light chains, that combine with multiple integrin beta chains to form different integrins. Among the known associating beta chains (beta chains 1,3,5,6, and 8, 'ITGB1', 'ITGB3', 'ITGB5', 'ITGB6', and 'ITGB8'), each can interact with extracellular matrix ligands, the alpha V beta 3 integrin, perhaps the most studied of these, is referred to as the Vitronectin receptor (VNR). In addition to adhesion, many integrins are known to facilitate signal transduction. The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.

Specifications

• Accession Number: P06756
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3685
• Name: Human CD51 (aa 884-984) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110004F14Rik; 2610028E01Rik; alpha v integrin; antigen identified by monoclonal antibody L230; Cd51; CD61; D430040G12Rik; Dnmt3l-ps1 pseudogene; GP3A; GPIIIa; integrin alpha V; integrin alpha-V; Integrin alpha-V heavy chain; Integrin alpha-V light chain; integrin alphaVbeta3; integrin subunit alpha V; integrin, alpha V; integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51); ITGAV; ITGB3; MSK8; Vitronectin receptor; vitronectin receptor alpha polypeptide (VNRA); vitronectin receptor subunit alpha; VNR; VNRA; VTNR
• Common Name: Integrin alpha V (CD51)
• Gene Symbol: ITGAV
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining