missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212153

Invitrogen™ Human CD42d (aa 179-242) Control Fragment Recombinant Protein

Product Code. 30212153
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212153

Brand: Invitrogen™ RP109299

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139912 (PA5-139912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Natural killer (NK) cells in teleosts and their evolutionary homologue are a subpopulation of lymphocytes with properties that distinguish them from either B- or T-cells. NK cells are important effectors of innate immunity where they release cytokines, which in turn up-regulate other immunological functions. Monoclonal antibodies have been used to identify different surface antigens present on NK cells. These surface antigens have not only been used to identify NK cells, but also their functionally distinct subsets. The Cluster of Differentiation (CD) nomenclature was established to standardize the naming of NK cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P40197
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2814
Name Human CD42d (aa 179-242) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CD42d; Glycoprotein 5; glycoprotein 5 (platelet); glycoprotein 5, platelet; glycoprotein V (platelet); glycoprotein V platelet; GP5; GPV; Platelet glycoprotein 5; platelet glycoprotein V; Platelete glycoprotein 5; Platelets GP V; PLGPV
Common Name CD42d
Gene Symbol Gp5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.