Invitrogen™ Human CD2AP (aa 146-272) Control Fragment Recombinant Protein

Product Code. 30199909

Brand: Invitrogen™ RP101069

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51879 (PA5-51879. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a scaffolding molecule that regulates the actin cytoskeleton. The protein directly interacts with filamentous actin and a variety of cell membrane proteins through multiple actin binding sites, SH3 domains, and a proline-rich region containing binding sites for SH3 domains. The cytoplasmic protein localizes to membrane ruffles, lipid rafts, and the leading edges of cells. It is implicated in dynamic actin remodeling and membrane trafficking that occurs during receptor endocytosis and cytokinesis. Haploinsufficiency of this gene is implicated in susceptibility to glomerular disease.

Specifications

• Accession Number: Q9Y5K6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23607
• Name: Human CD2AP (aa 146-272) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adapter protein CMS; AL024079; C78928; Cas ligand with multiple SH3 domains; Cas ligand with multiple Src homology 3 (SH3) domains; CD2 associated protein; Cd2ap; CD2-associated protein; CMS; mesenchyme to epithelium transition protein, SH3 domains; mesenchyme-to-epithelium transition protein with SH3 domains 1; Mets1; METS-1; SH3 domain-containing adapter protein; SH3 domain-containing adaptor protein METS-1
• Common Name: CD2AP
• Gene Symbol: CD2AP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining