Invitrogen™ Human CD298 (aa 115-172) Control Fragment Recombinant Protein

Product Code. 30203528

Brand: Invitrogen™ RP103039

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83937 (PA5-83937. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2.

Specifications

• Accession Number: P54709
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 483
• Name: Human CD298 (aa 115-172) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA409958; AI664000; Atp1b3; ATPase Na+/K+ transporting subunit beta 3; ATPase, Na+/K+ beta 3 polypeptide; ATPase, Na+/K+ transporting, beta 3 polypeptide; ATPase, Na+K+ transporting, beta polypeptide 3; ATPB-3; AW212096; CD298; CD298 antigen; Na K-ATPase beta-3 subunit; Na+/K+ -ATPase beta 3 subunit; NKAB3S; Sodium Potassium ATPase; Sodium/potassium-dependent ATPase subunit beta-3; sodium/potassium-transporting ATPase subunit beta-3
• Common Name: CD298
• Gene Symbol: ATP1B3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining