missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD273 (B7-DC) (aa 147-220) Control Fragment Recombinant Protein

Product Code. 30208656
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208656

Brand: Invitrogen™ RP90599

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82484 (PA5-82484. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Programmed death-ligand 2 (PD-L2), or B7-DC, is a member of the B7 ligand family within the immunoglobulin superfamily that, along with programmed death-ligand 1 (PD-L1), acts as a ligand for programmed cell death protein 1 (PD-1). Though expressed primarily in dendritic cells, PD-L2 expression can be induced on a wide variety of immune and non-immune cells depending on the microenvironment. PD-L2 expression is particularly upregulated in the presence of Th2 cytokine, IL-4, as well as Th1 cytokines, TNF-alpha and IFN-gamma to a lesser degree. While generally expressed at lower levels compared to PD-L1, PD-L2 demonstrates a 2 to 6 times higher relative affinity to PD-1 than PD-L1. PD-1 and its ligands are referred to as inhibitory immune checkpoint molecules in that they provide useful negative feedback during physiological homeostasis. Ligation of PD-L2 or PD-L1 inhibits activation, proliferation, and cytokine secretion (e.g. IFN-gamma, IL-10) in T cells, ultimately dampening immune response. Conversely, studies have shown that PD-L2 can also stimulate T cell proliferation and cytokine production, even in PD-1-deficient T cells, suggesting additional receptors. Recent studies have concluded that PD-L2 also binds to a second receptor, repulsive guidance molecule b (RGMb), which was originally identified as a receptor for bone morphogenetic proteins (BMPs). RGMb is expressed in the central nervous system, as well as in macrophages, however, its role in immunity is only beginning to emerge. Interaction between PD-L2 and RGMb regulates the development of respiratory tolerance in the lung through BMP and/or neogenin signaling pathways. The naturally occurring human PD-L2 monomer consists of a 201-amino-acid extracellular domain, a 21-amino-acid transmembrane domain, and a 32-amino-acid cytoplasmic domain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BQ51
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80380
Name Human CD273 (B7-DC) (aa 147-220) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B7 dendritic cell molecule; B7DC; B7-DC; bA574F11.2; Btdc; Butyrophilin B7-DC; butyrophilin-like protein; CD273; F730015O22Rik; MGC124039; MGC124040; PD1 ligand 2; PD-1 ligand 2; PD-1-ligand 2; PDCD1 ligand 2; PDCD1L2; Pdcd1lg2; Pdl2; PD-L2; Programmed cell death 1 ligand 2; programmed death ligand 2
Common Name CD273 (B7-DC)
Gene Symbol PDCD1LG2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.