Invitrogen™ Human CD23 (aa 185-308) Control Fragment Recombinant Protein

Product Code. 30205332

Brand: Invitrogen™ RP90049

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82370 (PA5-82370. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD23 is a 45 kDa glycoprotein which is present on a subpopulation of freshly isolated peripheral blood and tonsil B cells and strongly expressed on EBV-transformed B lymphoblasts. The CD23 molecule is identical to the low affinity IgE receptor found on B cells. Expression of CD23 has been detected in neoplastic cells from cases of B cell chronic lymphocyctic leukaemia and some cases of centroblastic/centrocytic lymphoma. CD23 is present on a subpopulation of freshly isolated peripheral blood and tonsil B cells and strongly expressed on EBV-transformed B lymphoblasts. Functionally, CD23 is involved in B cell growth and differentiation, and IgE production. Further, CD23 has a soluble form that is a potent mitogenic factor. Diseases associated with CD23 dysfunction include chronic conjunctivitis and chronic lymphocytic leukemia.

Specifications

• Accession Number: P06734
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2208
• Name: Human CD23 (aa 185-308) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BLAST-2; CD23; CD23 antigen; CD23A; CLEC4J; C-type lectin domain family 4 member J; C-type lectin domain family 4, member J; Fc epsilon receptor II; FC epsilon RII; Fc fragment of IgE receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); Fc receptor alpha multiple ligand receptor; Fc receptor, IgE, low affinity II, alpha polypeptide; Fcalpha muR; Fcalpha RII; Fce2; fc-epsilon-RII; FCER2; Fcer2a; FceRII; IGEBF; Immunoglobulin E-binding factor; immunoglobulin epsilon-chain; low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; low-affinity IgE receptor; Ly-42; lymphocyte IgE receptor
• Common Name: CD23
• Gene Symbol: FCER2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining