Invitrogen™ Human CD22 (aa 450-538) Control Fragment Recombinant Protein

Product Code. 30194491

Brand: Invitrogen™ RP109832

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD22, also known as BL-CAM, is a type I transmembrane glycoprotein composed of two polypeptide chains, CD22alpha and CD22beta, with molecular weights of 130 and 140 kDa, respectively. These chains are produced by alternative splicing of the CD22 gene. CD22 is prominently expressed on mature B cells and B cell lymphomas, including hairy cell leukemia, diffuse large B-cell lymphoma, and nodular lymphocyte predominance Hodgkin's lymphoma, but is negative in classical Hodgkin's lymphoma. The extracellular portion of CD22 contains seven Ig-like domains that preferentially bind alpha2,6-linked sialic acid moieties found on epithelial, endothelial, B, and T cells. This binding can be masked by cis interactions with sialic acids on the same cell surface. CD22 expression is limited to late stages of B-cell differentiation, making it useful for phenotyping mature leukemias. Intracellularly, CD22 features six tyrosine residues within immunotyrosine-based inhibitory motifs (ITIM) and activation-like motifs. These residues are phosphorylated upon B-cell receptor engagement, allowing CD22 to regulate B-cell receptor signaling. CD22 participates in positive regulation through interactions with Src family tyrosine kinases and acts as an inhibitory receptor by recruiting cytoplasmic phosphatases via SH2 domains, which block signal transduction through dephosphorylation of signaling molecules. CD22's role in both positive and negative regulation of B-cell signaling, along with its specific expression pattern, makes it a valuable marker for antibody customers interested in B-cell-related research and diagnostics.

Specifications

• Accession Number: P20273
• Concentration: 2.6 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 933
• Name: Human CD22 (aa 450-538) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A530093D23; B-cell receptor CD22; BL-CAM; B-lymphocyte cell adhesion molecule; B-lymphocyte cell adhesion molecule (BL-CAM); Cd22; CD22 antigen; CD22 molecule; FLJ22814; Lectin 2; Leu-14; Lyb8; Lyb-8; MGC130020; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; Sialic acid-binding Ig-like lectin 2 (Siglec-2); Siglec2; Siglec-2; T-cell surface antigen Leu-14
• Common Name: CD22
• Gene Symbol: CD22
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining